SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA09434 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA09434
Domain Number 1 Region: 17-76,107-272
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.42e-38
Family GidA-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA09434   Protein: JA00804   Gene: WBGene00128639
Sequence length 648
Comment JA00804 WBGene00128639 status:Predicted
Sequence
MLSKTSRIFRRCLQTDVDVIVIGGGHAGCESAAASARCGSKTILITQNRNTIGEMSCNPS
FGGIGKGHLIREVDALDGLCGRICDKSAITYQALNRAQGPAVLGLRAQIDRKLYKKHMQE
EIKRTERLEVLEGEVAELLVQNQRIVGVKMANEEVISTKCVVITTGTFLRAQIYQGLASW
PAGRINEKSSDKLSESFLKLGFELGRLRTGTPPRLFKETIDFSKFELVKPDEIPIPFSFM
TDNVWIKYEDQLPTYLGHTNDEVCRIGHENIHENLQVSSETTSPRYCPSLESKLLRFPKL
HHRLFLEHEGLDSPHIYPQGMSMTFKYPPDVFLLQPEIQKRLLRAIPGLENVELYQPGYG
VQYDFVNPQQLQKTLETRKIRGMFLAGQINGTTGYEEAAAQGVIAGVNAAARAQNGQPME
VKRTEAYIGVLIDDLTSLGTNEPYRMLTSRAEFRLHLRPDNADIRLTSLGRCHGAISESR
WTKFSKSKQKLANLTENAENMSMSVAKWKRIVPKLQSSTKNEGKVLTAFELIHRFDLEPE
DVSGVLNSENEIISPDAFERMKIEGRYRMEHERMKSKKLEIERESATEIPDHLDFSKMRG
LSQECIEKLERARPRNLAAATRIAGITPEAIVVLMRYLKSPSGVNLSC
Download sequence
Identical sequences CJA09434 281687.CJA09434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]