SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA10398 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA10398
Domain Number 1 Region: 9-354
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.6e-65
Family DnaQ-like 3'-5' exonuclease 0.0012
Further Details:      
 
Domain Number 2 Region: 340-399,467-487
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000000000000635
Family DNA polymerase I 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA10398   Protein: JA38189   Gene: WBGene00129602
Sequence length 498
Comment JA38189 WBGene00129602 status:Predicted
Sequence
MMKTRKDIMPLVRKNTERIKKESAYADYLARNLGGGTSDGKERLDGDILSQIVDIREYDV
PFHMRVSIDEKIFVGLWYDVKGVGPNRVPVIKRKDLAFFHAKPKVLAFDIETTKLPLKFP
DRESDEIMMISYMVDGQGFLIINREIVSADINAFEYTPKAEYKGEFVVWNEKDETALIRK
FFDHFLQYFCPYFPKFQVRPNIVVTYNGDFFDWPFVEARAKIRGFNMEREIGFSKDSADE
YKSRNCIHMDAFRWVKRDSYLPVGSQNLKAVTKAKLRYDPVEVEPELMCKMAREQPQQLA
NYSVSDAVSTYYLYMKYVHQFIFALCTIIPLGADDVLRKGSGTLCEALLMVEAFHNNIVF
PNKYTGPEEARFSKDGHRVESETYVGGHVEALEAGVFRADIPAKFRLKPEALQQLKDEVD
ETLRKELVREFGVSLDQVVDFEQQCEEVKSAFDGLLAAPTRLENPRIYHLDVGAMYPNII
LTNRLQSSCANHRQNRAA
Download sequence
Identical sequences 281687.CJA10398 CJA10398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]