SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA10542 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CJA10542
Domain Number - Region: 67-150
Classification Level Classification E-value
Superfamily FliG 0.0418
Family FliG 0.011
Further Details:      
 
Domain Number - Region: 207-233
Classification Level Classification E-value
Superfamily HIV-1 VPU cytoplasmic domain 0.0863
Family HIV-1 VPU cytoplasmic domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA10542   Protein: JA20708   Gene: WBGene00129746
Sequence length 249
Comment JA20708 WBGene00129746 status:Predicted
Sequence
MEKVGLYVEEMNADQRRKVDRLASRSISESKSPMETPWVRMTEEEMSVKMRSKLLKGFDK
FLQNSGKMEEDVLEKIASNTTCSEQTKSIVVEQLRKFSEELRCRWSALGGVTWMKSVMNV
MRALDVENADDLERSFVEMRNSNECAEKWRNKYEMLKKELFDLQNKWAVEKENLKSAVRE
LSKTAGHLRRRAEEAEMTAKTAKQGQGIRKNAEDSSNESETSDELLSMREKIQGQASWKS
RRSTASRIS
Download sequence
Identical sequences 281687.CJA10542 CJA10542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]