SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA10774 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA10774
Domain Number 1 Region: 24-251,352-496
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.14e-57
Family FAD-linked reductases, N-terminal domain 0.00000000409
Further Details:      
 
Domain Number 2 Region: 250-352
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.88e-32
Family Electron transfer flavoprotein-ubiquinone oxidoreductase-like 0.00000885
Further Details:      
 
Domain Number 3 Region: 498-598
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.86e-26
Family ETF-QO domain-like 0.0000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA10774   Protein: JA32182   Gene: WBGene00129978
Sequence length 600
Comment JA32182 WBGene00129978 locus:Cjp-let-721 status:Partially_confirmed
Sequence
MRISGVTLFRASSQLRNVVNGQWTTTHYTVKDRSQDPRWKDVDMARESDVYDVVIVGGGP
SGLSAAIRLRQLAEKAQKELRVCVVEKASIIGAHTLSGAVIETRALDELFPNWKELGAPV
HQEVTSESIAILTETGRIPVPVFPGVPLANHGNYIVRLGKVVQWLGEQAEAAGVEVWPEI
AASEVLYNEDGSVKGIATSDVGIGKDGAPKDGFARGMEFHAKCTVFAEGCRGHLSKQVLD
KFNLRTHAMTYGIGLKELWAIDPAKHRPGYIEHTMGWPLVRENVDQYGGSFLYHIEDGGQ
PLVSVGFVVALDYKNPHLNPYKEFQKYKTHPSIAKQLEGGKRIGYGARALNEGGFQSIPK
LHFPGGCLVGCSAGFLNVAKLKGTHNAMKSGMVAAEAIFDEIQQKGDDVQTVDPAAYEKN
IRETYVVKELKATRNIRPSFNTSLGYIGGLIYSGLFYVFGRGLEPWTLGHGKKDNEKLIP
AKEAKEIEYPKPDGKLTFDLLTSVSLTGTNHNEDQPAHLTLKNDQVPLDVNLATYGGPES
RFCPAGVYEFVPSEADESKKRLQINAQNCIHCKTCDIKDPRQNINWVTPEGGGGPKYEGM
Download sequence
Identical sequences 281687.CJA10774 CJA10774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]