SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA10817 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA10817
Domain Number 1 Region: 25-233,286-335
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.88e-49
Family N-terminal domain of adrenodoxin reductase-like 0.0002
Further Details:      
 
Weak hits

Sequence:  CJA10817
Domain Number - Region: 164-401
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0012
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA10817   Protein: JA36134   Gene: WBGene00130021
Sequence length 474
Comment JA36134 WBGene00130021 status:Predicted
Sequence
MYTRRIIPSIDVLYFGTKPRRLSTKPRLAIVGSGPAGMFACNGVLRKSDFNVDVFEYSPV
PFGLVRYGVAPDHQEVKNVIKQFDQMFERNRNRLRLFCNVKIGRDVTFDELTHGYDAVLL
AYGSHKTRQLGIPGSDSKNVISGSDFVGWYNGVPHAPTPDLSATDVVIVGNGNVALDCAR
VLSTASSGALRATDIPDDRLVVLEKVPIKDIKILGRRGPEHVAVQNQRMGQQIGNLGRRS
KTFNRKHSKARKEEKAVNRGIKLTLFSFSVLFFQVLVKNIGVSVGPKQCHFLFHRVPQKI
EADHDGKVRSVILKNTESGKTEVLPCGLLIYSLGYETLVLDGVPQNDKQMIDMRDHVRVE
TNLACPAQVYATGWCAHGPRGVIVDTQQQSIFVANQIAEDFANNRKSSARGVAALLEERK
VPFISWDAWKQIDQQEREKGAKSGKIREKFTTFESAIILGEVRCNCALPARIRD
Download sequence
Identical sequences 281687.CJA10817 CJA10817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]