SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA11645 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA11645
Domain Number 1 Region: 153-587
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.07e-132
Family Reverse transcriptase 0.0000306
Further Details:      
 
Domain Number 2 Region: 783-934
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.4e-36
Family Retroviral integrase, catalytic domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA11645   Protein: JA26693   Gene: WBGene00130849
Sequence length 1156
Comment JA26693 WBGene00130849 status:Predicted
Sequence
MGNQQERDSRPGNYRLYLGENTTFPAESEQRVKGILNKKLINHDMVVHQQSDLFDRLGLS
ITPTVFRSQNALLLVTNPTRTDITVPARATIANVGRIHTAPDGSLHCSDTASDEAFPNIA
TTDSRLQPLDPDFKIDFNSIQCKEEERRQLKQLCEDYADVLSRNPYDLGSSKTDPVHIYT
TSEVPVKSRPYRVPVKYQAELEQHINALIRSERITESNTPWTSPIVLVKKKSGALRVCLD
FRRLNDITIPDNFPLPRIDAILEKVGGARYFSSLDMANGYLQLRLDAESSYKCGFITETK
VFAYTHLPFGLKSAASYFQRALKTVLANMDRDVLVYIDDILIYSQDFGQHIATLRNVFDR
FRQFNLKVSPKKCEFLKKAITFLGHTITESNYTPNEANVKSIAEMSTPKNLAEIRRFVGM
VGFFRKFLPNLATVAEPLTRLNRKNEKFRWETPQQEAFDTLREALLDKPILAFPDYENPF
HLFCDASAVGLGAALMQAETEEEKHFKAIAYTSRTLADSETRWPAIQVELLSIIFALRHF
RPYICLSKIILHSDHRPLSYLLSKHKVNDNLARWLIELQQYDIKIVHIDGKKNTVADYLS
RMQGESQPKEAELEDIVSFPICMANTTYEHVPPTVLKISGMNSIDINEEQRKDPVLVSVR
ALIEKRPTPCIDLPSEWKHYLKFVKISKRGTLVINFPGTPGLAEDKTIVPGALQELVITG
HHASLLGGGHFHWRPTMHKTQKKFFWPGMRTSIIQHCLRCQQCQLRRSKPPAQREQQLVV
PTNYVFQRVGIDLTGPLPVTAQGNRYYMNAICWFTRYVISIPLPDTRADTCARALLNHVV
LKYGAMSELISDGASGFTSTAFEHFCALLEIQHHTAIPHHSRGNGATERTFRTFHNSMAK
YVNNKHNDWEDHLQAVAFAYNTAQHSTTGESPFYLMYGRDPVFPIEKIIHPEPGNDATQD
PHEWKHHLTTTIQQAWRDAADHTEIAQGRYNNTANLGARPIDVKSGDLVVMRNFKSKVGL
SRKLVMPWEGLYRITSLERPFAYIVECRRPTKPPRKVHLDQIKKFLETSTSTRPSHQQVD
LSPAQLPPIARSATPMRTSGNIVASPSQNGPYTRAMPSSASRQPLPPPLVTGTAVNHDDT
PYVLRKTRRKPVRYRD
Download sequence
Identical sequences CJA11645 281687.CJA11645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]