SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA12302 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA12302
Domain Number 1 Region: 161-287
Classification Level Classification E-value
Superfamily ISP domain 7.33e-39
Family Rieske iron-sulfur protein (ISP) 0.00000429
Further Details:      
 
Domain Number 2 Region: 93-164
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 0.000000000000327
Family ISP transmembrane anchor 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA12302   Protein: JA17745   Gene: WBGene00131506
Sequence length 290
Comment JA17745 WBGene00131506 locus:Cjp-isp-1 status:Partially_confirmed
Sequence
MASLARSGGFAVKVISGSQPHANFVAATPAAASVVAFREVPAEFSTAEARQAQVTRSTQG
VFSNGLAVKGINGILLFLTICLNEFLVTSRRLAHTDVTFPDMTNYRRDSTKNTQAAARDS
EDQRRALPTALYYGAGGVLSLWAGKEVVQTLVYYKAMAADQRALASIEINMTDIPEGQTK
TFEWRGKPVFVKHRTKAEIAKEKAVTVGDLRHPQHDDERVQKDEWSVVIGVCTHLGCVPI
ANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLHVPAYSFKDNTIVIGSS
Download sequence
Identical sequences CJA12302 281687.CJA12302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]