SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA12977 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA12977
Domain Number 1 Region: 64-186,217-327
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.14e-38
Family FAD/NAD-linked reductases, N-terminal and central domains 0.072
Further Details:      
 
Domain Number 2 Region: 626-711
Classification Level Classification E-value
Superfamily EF-hand 7.33e-17
Family Calmodulin-like 0.015
Further Details:      
 
Domain Number 3 Region: 326-420
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000129
Family D-aminoacid oxidase-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA12977   Protein: JA35875   Gene: WBGene00132181
Sequence length 737
Comment JA35875 WBGene00132181 status:Partially_confirmed
Sequence
MSWVRFTKTGVAVVATSAATILALDMTNERRFQRQMKDYFRTVHADRLAELNKRAPSALP
TRKDILESLSKGEEFDVLIIGGGATGAGVVLDAQTRGLKTALVELDDFSSGTSSRSTKLI
HGGVRYLQAAIMKADLEQYRMVKEALFERHNLLEIAPHLSSPLPIMLPIYKLWQVPYYWS
GIKAYDFVSGKRVLKNSFFISKSQALERFPMLRNESLKGALIYYDGQHNDARMNLAIILT
AIRHGAVSPALLYKTCAADLQRCANHVRVEKLNKDETGKVIGAHVRDMVTGGEWDIKAKA
VVNATGPFTDAVRLMGDPDTAKPICMPSSGVHITLPGYYSPSNTGLLDPDTSDGRVIFFL
PWERMTIAGTTDAPSDVTMSPQPTDHDIEFILQEIRGYLSKDVSVRRGDVMSAWSGLRPL
VRDPNKKDTKSLARNHIIEVGKSGLITIAGGKWTTYRHMAEETVNKVVEVHNLQTESGCV
TPGLLLEGAHDWNSLQYIHLVQDYGMEVDVAQHLSQTYGDRAFVVARMCKMTGKRWPIVG
NRLHPEFPYLDAEVRYAVREYACTAVDVIARRMRLAFLNTYAAHEVLPDVVRIMGEELGW
SSAEQRSQLEKARTFIDLEMGQNAKQTAVTNAPLNLTRDEMQRARERFHQLDKDRKGHIT
VNDLRKHFREHNQKIDERVLHELLNEVDLNKNGEIEIAEFFQLYSGLKGGQLTSNRLVGY
LDEIHGTPSVNRACGGI
Download sequence
Identical sequences CJA12977 281687.CJA12977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]