SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA13373 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA13373
Domain Number 1 Region: 239-400
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.52e-36
Family Retroviral integrase, catalytic domain 0.012
Further Details:      
 
Domain Number 2 Region: 3-55
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.0000178
Family Reverse transcriptase 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA13373   Protein: JA36834   Gene: WBGene00132577
Sequence length 892
Comment JA36834 WBGene00132577 status:Predicted
Sequence
MMSALRRFKTIIYGTPVVVLTDHKPLMYLLKGTPLADRLLRWSIEILEFNVKIVYLKGKA
NEVADALSRGGCSPVESEDTETTELNMIVNEIRGEKSDDVLDNSNWFEWLKEEDEGWNEI
IDKLENGEEKCRVKVLGMKGEVPVDHYALIGKSLRNTEIEGTCRFVVPKRARAALLQEAH
EGVLAGHFGTEKMVRQLSRRFFWPKMRASIQSCVKACAKCLCTNDAPKLVAPLTPYDTTY
PLEVVACDLIDVGLSVQGNRYILTILDLFTKYGTAVPIPDKTSETVLKAFNERWALGEGR
IPHTLLTDQGKEFDNGMFQQFTRMLKIRHEMTKGYNSRANGAVERFNKTLMHIVKKKTAV
AMEWDDQVVFAVYAYNNVAHTTTGETPTYLMYGRDSRGPLEMDGEDAVGINYADMDEYKH
ILTHELLKTQKIVKEHAMGEHEKYKRLFDEKHRTATRKYPEPGSRVLVEIPAEKLGAKCP
KLINKWKGPFRVLECSNNSATLTPVLGKGKDVICVPFDHLRVVPDEMGDEEIKTKKGRAK
KKVAHLEGDFCDEVSMRDPNETFFRHIFSCRCSRPCVFYPPSATTARTTSPSQLVAMMNL
LELKPELAQKPTELLLLAQANLPFEVDIPSQEALLAMAHCPTLQLMCREEPAWNVAFTHT
FSALMRRFFGDDFTSQPVNTLLVLAPGVRESTVTLAFTEKLVLKRAESAEDLLLEQLNRK
RYSRLIMILPFATDDEHVDQWTSLMDVVPESTRMLMIPAPTALEDFSLAEAFISRVASVE
RPRGHLDVISPEDRVMAHKNLRLVDLGDKMSPQDYWHVVNDVMLARKLEWQGLKVVDGDK
SHSRTRMEPIGIERRSHTAAARKVPRIGDRVMPYDVSKRLRQERHQHHRPSQ
Download sequence
Identical sequences CJA13373 281687.CJA13373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]