SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA13610 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA13610
Domain Number 1 Region: 4-215,318-377
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.9e-39
Family FAD-linked reductases, N-terminal domain 0.0001
Further Details:      
 
Domain Number 2 Region: 226-318
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000000000000145
Family D-aminoacid oxidase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA13610   Protein: JA27931   Gene: WBGene00132814
Sequence length 381
Comment JA27931 WBGene00132814 status:Partially_confirmed
Sequence
MSTDYDVIVVGAGIFGSCTAYNCQKLGLKTLLLEQFELGHVNGSSHGKSRITRYAHTEVE
YVPLVSDAYEQIFELERIRGEKLWKKTGLLWVSTGNEVEKIHNNLKSKNIEHEVVKGTEI
ESRYPQFKFNDEWNGLIDPMGGVIYANKWLHAFQDQFKKIGGIIHDHEAVLSHSENGEIL
SVVTPKSRYTTKKIIFTVGCWITKFLPHVNFNIEHFRLLLESQNQADSFLLNEDHYPVVI
AQEMDLKVFHYSLPDTDYPGAIKFCYHYGDPLTKDNKHPEQRSQRCIDLPADFIKKYMPV
VDGSAPTKVDKCIYTNSPDDHYIIGRVPGKNANILVGGCGSGSGFKVAPGIGKALAEMAA
GRKTTVDVSFFSADRFKPSKI
Download sequence
Identical sequences 281687.CJA13610 CJA13610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]