SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA13620 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA13620
Domain Number 1 Region: 7-373
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.32e-52
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000289
Further Details:      
 
Domain Number 2 Region: 339-453
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 2.41e-33
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0000071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA13620   Protein: JA00208   Gene: WBGene00132824
Sequence length 459
Comment JA00208 WBGene00132824 status:Partially_confirmed
Sequence
MSGVKEFDYLVIGGGSGGIASARRAREFGVSVGLIESGRLGGTCVNVGCVPKKVMYNCSL
HAEFIRDHADYGFDVTVNKFDWKVIKKSRDEYIKRLNGLYESGLKGSSVELIRGRAAFAE
DGTVEVNGAKYRGKNTLIAVGGTPTIPKIPGAEYGIDSDGFFELEDLPSRTVVVGAGYIA
VEIAGVLANLGSDTHLLIRYDKVLRTFDKMLSDELTTDMEEETNPLHLHKNTQVTEVVKG
ADGLLTVKTTTGVIEKVQTLIWAIGRDPLTKALNLERVGVKTDPQGHIIVDEYQNTSAPG
ILSIGDDTGKFLLTPVAIAAGRRLSHRLFNGESENRLIYENIATVVFSHPLIGTVGLTEA
EAVAKYGKDEVTLYKSRFNPMLFAVTKHKEKAAMKLVCVGKDERVVGVHVFGVGSDEMLQ
GFAVAVTMGATKKQFDQTVAIHPTSAEELVTMRGGVKPE
Download sequence
Identical sequences A0A2H2IEY5
281687.CJA13620 CJA13620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]