SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA13671 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA13671
Domain Number 1 Region: 40-337,530-591
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.09e-74
Family FAD-linked reductases, N-terminal domain 0.00015
Further Details:      
 
Domain Number 2 Region: 339-531
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.24e-54
Family GMC oxidoreductases 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA13671   Protein: JA36616   Gene: WBGene00132875
Sequence length 607
Comment JA36616 WBGene00132875 status:Partially_confirmed
Sequence
MLQNRAIRSLHVTTKRFFNWRDSMKEGTFSADVQENKPTHIIVGAGSAGCVLANRLSEDP
SNRVLLIEAGPVDHKWDWRIHMPAALMYNLCSETYNWHYHTTAQKNLGNRTFYWPRGRVW
GGSSTLNAMCYVRGHAFDYDRWEKEGASGWNYANCLPYFKKSETYSHSTGENDPYRGHNG
PLFVEKGNAENPLHKAWLKVGEEHPLGNSDDMNGERQEGISTMDMTIHKGERWSASKAYV
HPIRNRPNLITSSGITCTRVLFDKNRAIGIEFIRKLNFVGTENIDSYIREKIYCQGDVIL
AGGAINTPQILMLSGVGPASHLHAHEIPLVVDLPGVGQNLQDHLEIYVQQECTQPVTLYD
KSSWKFPHNMIKIGLEWFTNRTGLGASSHLETGGFARSDDKVRHPDIQFHFLPSTVHDDG
RTNGTCHGYQSTIKTVQVHVGPMRSQSKGYIMLQAKDPRRAPIINPNYMDEDADWREFRK
CIRLSRELFASKAFDEYRGKELAPGPDTQSDADIDRFVKEKAASAYHPSCTCKMGSESDK
MAVVNPETMGVYGTENLKVVDASVMPSIVSGNLNAPVIMMAERAADLIKHKKQMLPPSTA
NVWKKTV
Download sequence
Identical sequences CJA13671 281687.CJA13671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]