SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA13962 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA13962
Domain Number 1 Region: 8-233
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.37e-48
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0096
Further Details:      
 
Domain Number 2 Region: 316-494
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000022
Family FAD/NAD-linked reductases, N-terminal and central domains 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA13962   Protein: JA07168   Gene: WBGene00133166
Sequence length 537
Comment JA07168 WBGene00133166 locus:Cjp-fmo-1 status:Confirmed
Sequence
MPTNTSKSNKKLLIVGAGASGLPSLRHALLYGLDVTCFERTDQTGGLWNYKPHETDLSSV
MKTTVINTSKEMTAYSDFPPESRMANFMHNSEMNRYLQNYAKHYELAKHIKFNHKVNSID
RNADYETSGKWKVNYTDDKGATHDAVFDGVLLCSGHHTLPHWPKKFPGQDEFKGRIIHSH
SYKDHRGYEDKIVVVVGIGNSGGDVAVELSRIAKQVYLVTRRGTWIFNRIYDYGQPIDIA
MNRKFISDLREYVPQWISNTVVEAKLNMRFDHKTYGLKPKHRVFGAHPTVNDELPNRIAC
GTVRIKPNINKFTEHGVLFDDGTKLEHVDEVVMSTGFSFEFNLVENGDLIKVHENQVSLY
QYMFPVELGNHNTLAVIGLVQPFGSIMPLSEMQARVFLEEFTGKQVLPSKAEMEDNVTRK
HDDMSKRYVTSRRHTIQVDYVDYIEELAKLIGCNLDMKRLWKEDPWLAYKVYFGPRVPYV
YRLNGPHKWDKARNAIMTVDERVLLATNDNATVEADYTVLYAAIGLIGLIVLVYILF
Download sequence
Identical sequences A0A2H2IFG5
CJA13962 281687.CJA13962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]