SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA14306 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA14306
Domain Number 1 Region: 95-365,473-531
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.57e-31
Family FAD-linked reductases, N-terminal domain 0.0095
Further Details:      
 
Weak hits

Sequence:  CJA14306
Domain Number - Region: 389-467
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.0104
Family L-aminoacid/polyamine oxidase 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA14306   Protein: JA31177   Gene: WBGene00133510
Sequence length 543
Comment JA31177 WBGene00133510 status:Partially_confirmed
Sequence
MRNLALFTQTVRPALSSARLVHTTSPLNWQRFENERHFEPGEDVMKRVWHGLSYDFRRWK
RRFQEARKDAFQRRHPIAHMKHGTLDNEVFPYRAEIVIIGGGLTGSSTAFWLKERFRDED
FKVTFVFSVLKATIHIFQVVVVENNDVFTKSSTMLSTGGITQQFSIPEFVDMSLFTTEFL
RHAGEHLRILDSEQPDINFFPTGYLRFAKTEEEVETMRSAWKVQIERGAKVQLLSKDELA
EMYPYMNVDDVLLASLGVENEGTIDTWQLLSAIREKNITLGVQYVKGEVEGFQFERQRAS
SEVHAFGDDATADENKLRAQRLSGVLVRPQMNDATARPIRAHLIVNAAGPWAGNVAKMAG
IGKGSGLLAVPVPVQPRKRDVFVVYAPDVPVDLPFLVDSTTGVYCRQSDCGHTFLVGRTP
SKEEDAKRNHENLEVDYDDFYQNIWPVLTDRVPGFQTAKIKNAWSGYQDVNTFDDAPIIG
EHPLYTNLHMMCGFGERGVMHSMAAARAYAERIFDGAYINVNLRKFDMRRIVKMDPISEP
CRL
Download sequence
Identical sequences CJA14306 281687.CJA14306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]