SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA15233 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA15233
Domain Number 1 Region: 21-343
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-44
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000627
Further Details:      
 
Domain Number 2 Region: 365-413
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0000395
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA15233   Protein: JA33156   Gene: WBGene00134437
Sequence length 414
Comment JA33156 WBGene00134437 locus:Cjp-trxr-2 status:Partially_confirmed
Sequence
MFLHAQEVNTARRLLSTATAQHFDLIVIGGGSGGLSCSKRAADLGAKVALIDGVEPTPHG
TTWGIGGTCVNVGCIPKKLMHQAALVGKELKTAEAYGWNGINQSAITHDWNVLVQNVNDR
IKGNNWVYKVQLNQKKVKYFKAFAEFVDKTTIVVTSADKKKTETVLTASKIVISTGLRPR
YPECVGRELGITSDDLFSLPKAPGKTLIVGAGYVALECAGLLAGIKQEVEVLIRSRPLKE
FDQDCVKLVMEHLKSTGVKVREGSEVAKVEAVGEKKRVTFTGSGHVEEYDTVIWATGRSP
KMASLKLSAANVKLEEQSGKILADEHDRTSTEGIYAIGDVVKKNFRNVQEPFYQDLTFLN
IFLFSGFAVAFRVGITYSDLELTVAIHPCSAEEFIKLNITKRSGKDPKPQGCCG
Download sequence
Identical sequences CJA15233 281687.CJA15233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]