SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA15363 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA15363
Domain Number 1 Region: 17-341,456-475
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.81e-48
Family FAD-linked reductases, N-terminal domain 0.0051
Further Details:      
 
Domain Number 2 Region: 322-438
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.73e-19
Family L-aminoacid/polyamine oxidase 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA15363   Protein: JA26822   Gene: WBGene00134567
Sequence length 516
Comment JA26822 WBGene00134567 status:Predicted
Sequence
MSNETSNGNKESSRKPSLSIAIIGAGISGLSTARRLMELGVDDFVIYEGLDRIGGRIHAV
PYKDGFLQMGAQFINGAQNPLYKIAHRLGILADAVSDTAHVDYAFYAYGNQQVKQADIKL
FLDFTSKLDSKYRAIAENDEITARRYTLKEIFTLDYMDFLKTHNFTTKQKNVFDSLARSF
RSYWEFEWAADWSTTFLVSWILAQFSIYSTLFQLSLHVLKEWNDYGTVCESFATDKIGFK
AILDDIAEPISKSHFQFNTRIDNIQLNSTTGRMKLTANGQTLPSEFDYVIVTSSLGVLKK
YHHLMFSPPLSRQKIEAIEKIGFGGSCKVFFEWDKPFWSNKTYSIAPLPVRGMIRDELDM
FEEETTTLQVVDWAPNVLSAWYAGRGHQLVDNMSEGELKFKIAKLMREMYNNEDIPLPKK
VIRTQLTKNELLLGSYSYMTQVQALSRISHSQLSMPVKLDGRPKILFAGEATHHRSAPHK
IIKTRRSRTSKCQPSTRRPSKRSKFTECSQLYFFFK
Download sequence
Identical sequences 281687.CJA15363 CJA15363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]