SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA15495 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA15495
Domain Number 1 Region: 792-958
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.03e-20
Family Retroviral integrase, catalytic domain 0.027
Further Details:      
 
Domain Number 2 Region: 116-413
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000000000004
Family Reverse transcriptase 0.02
Further Details:      
 
Weak hits

Sequence:  CJA15495
Domain Number - Region: 49-92
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00105
Family Retrovirus zinc finger-like domains 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA15495   Protein: JA31144   Gene: WBGene00134699
Sequence length 1060
Comment JA31144 WBGene00134699 status:Predicted
Sequence
MALDETPMDDENIHALYSMKAFPPRKCLFCEKACSRFYCQTYYGYDYINRATTAGVCLKC
YQRGHKGAQCPSRIVDSRICGATDHTEQGCQVRAEVIRSHQQQRRTDPRKSIKSGNLVTY
RFTRIPFGIACSPFLLDVAIRIHLESHPHPVNEKILNNLYVDNVLSTTNNRKELMFLYEH
SKAVFNKCQMNLREYLVNDRETMVNIPSHDQAKSTSSKLLGYAWDAGTDTMSITIAVLPK
SETPTKREIASFLGGTYDPMGLVCPITISTKMLMQLMWKEGVSLDSPISKKLLPEWKKIR
KAFEDPCYHFPRQLTTRYNYEEVQMLVFCDANDHNFAACVYLRFSFKDSPPVTNLYLAKT
RQKSLNQTSTTPRMELMAIEIGLNAAATFIQEKTVNVSQIKIFSDSQIALYWILKGDRCH
AFVSNRVATINDVVASLSGYNVTFHHVPGSCNPADIASRGATLAELKKSSLWQHGPDFLK
LSTDQWPNSLKKAKDYEEDELKAIMKELVMPTASTKKKLSKFQTVAINVLTAQTIDAAWK
TEAYTPRVFRRDFAQSYHTLARSKTTSSTQLLVAVSDDEFPFHKPGIRYKSFVPYTGTQS
MVKLTTTVGFIMKFLARAFPHQLWKTPLMKTLEQLENLPRTEEGSVRLSLQITARELVRN
YILKDHYLDDFFSNSGDNPGNFRLRCHRSLAPIRASDGLFHIRRPIEQSHASTSEKFPIF
VINDHPLAKLVARDLHIQNKHASEEQLIRILRKQYSISTDRRLCSHICRTCFHCRRQKAR
PYSSQFPTSRVCPTVPFQNIGIDYAGPIIYRGYPEVELKSYILVVTSLFSRAVHLELVPD
ESALSYLFAMRRVFARRGVPRLILSDNAGCFKLGGYILNGDIRREGPDSRSFSTYMAENE
IRCQYITPLSPWQGGVYERLVGLTKKLLRTTLGMLQPTYVELETQLVFIEGVLSNRPITK
NPALNTDRLALRPIDFLLPSVPLATPWVIDEKSFQQGTTTEKTTRKFAALLLESIGKLVD
EWSSSYLTGMHKAELPLGKSQRRIPRVDDVVLVYHEKYAX
Download sequence
Identical sequences CJA15495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]