SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA16735 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA16735
Domain Number 1 Region: 340-627
Classification Level Classification E-value
Superfamily Folate-binding domain 1.4e-68
Family Aminomethyltransferase folate-binding domain 0.0000929
Further Details:      
 
Domain Number 2 Region: 2-145,250-320
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.1e-29
Family FAD-linked reductases, N-terminal domain 0.0031
Further Details:      
 
Domain Number 3 Region: 145-249
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.82e-17
Family L-aminoacid/polyamine oxidase 0.026
Further Details:      
 
Domain Number 4 Region: 646-722
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.000000000000294
Family Aminomethyltransferase beta-barrel domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA16735   Protein: JA20762   Gene: WBGene00135938
Sequence length 724
Comment JA20762 WBGene00135938 status:Partially_confirmed
Sequence
NIDFQQTGTIRLATNETRLAEFKKYVSRDYYKEGDVCKTTLLSPAEVSQLAPAVDHTKVL
GALHTTNDGTISARALTQALVVGAKNGGAQVVDGAIPREIRYDKEQGNWIVVLEDGTVVT
TRNLINAGGIWANDIARLSGHDLPVVVVEHQYAVITPNKTPANTPSIIDHDSTFYVRKSG
DDYLFGGFENLEKTVIREDWYKNGVPTEGSKSIKADFSRLDNAYKRACELVPELQGAKVD
TRAAVFSMTPDGYPLVGPYDKNYWMSTGFLDGVSSGGGIGKYLADWIVDGEPPAELFDTD
ASRYERWGDRKFFTERSRETYSMYYNWSYTDRLAGRPTDRISGIYGRLKKDGASFSFRNG
WEVASSFNMGVQNESYLPTLIREYEMVTNKCGVIDLSWKGKIEVKGKDAEKLLDYAIASD
IPPLGKISSGVMLTRRGGILSPMMIFHHDRQRSAFILLTEPERESRDLYWLRRAAAEKQL
DVQVGLVSEYLASLALVGPKSREVLSALTKSDVSDEGFPQKSTRMIRLGPVGVVCARSST
STGQLSYELFHNRAETTKLYNAVMSAGREHGIVNFGQAALNMMRLEHGYRIWGKELTLDT
NPYECGLGSLVDFDKKEFIGRESALELSKQEFKRRLALITFDAEEGVVLDDRYVPSGNEV
IRIDGQEARVGQITSGAYNVRLQKPIAFAWIDASVGPNERLVVDIGDKRLTATSVETPTI
PPIQ
Download sequence
Identical sequences 281687.CJA16735 CJA16735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]