SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA17341 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA17341
Domain Number 1 Region: 18-195,322-439
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.1e-40
Family FAD-linked reductases, N-terminal domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA17341   Protein: JA20513   Gene: WBGene00136545
Sequence length 447
Comment JA20513 WBGene00136545 locus:Cjp-coq-6 status:Partially_confirmed
Sequence
MKLPGGTIISMRNASSYYDAVIVGGGMVGNAMACALGANKSFQSKSVLLLDAGRSPSLSS
FEQGTPFNNRVVATSPTSIDIFKRIVFSIDLRHENARLRPLICICLNNKYRAHFHYSEVA
YIIENDLIVGSLFEKMTEYKNIDVKTSVKVDECSIPNSLEHLAYVKLENGDVIETSLLIG
ADGVNSKVRHASDLNYTTFNYNQHGLVAIVEIQTASGKNDTAWQRFTTLGPVALLPLSDT
VSGLTWSTSPEEAQRLKQLPSDQFVDELNSALFSQDDQNQFVNQAIFALNRLNPFRPETF
GRKAEGTIPPHVINVQDKSRASFPLGFGNAHSYITTRCALIGDAAHRMHPLAGQGVNLGW
SDAQILNKVLGDAAREGADIGSITYLSEFDSAAQKHNLPVMVSVDLLNRLYRTDAPAIVA
ARSFGLNAFNSLGPVKNYLINYLSAHR
Download sequence
Identical sequences 281687.CJA17341 CJA17341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]