SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA17937 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA17937
Domain Number 1 Region: 71-149
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000047
Family FAD/NAD-linked reductases, N-terminal and central domains 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA17937   Protein: JA29658   Gene: WBGene00137142
Sequence length 155
Comment JA29658 WBGene00137142 status:Predicted
Sequence
MGHSGNFRQGNGATAVKIGESPLVRKAARGRCEDGARTARGRRDVGEGKIVRDSARGRRL
ARVKHEHGGSAVLASELAYSIRRNYENVKIHQVFEEKHVAQEILPALLAKKSTEAIEKSG
VQVKAEKQVKGVRKCCKNVVLQLSDGIELISARSL
Download sequence
Identical sequences 281687.CJA17937 CJA17937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]