SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA18437 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA18437
Domain Number 1 Region: 5-109
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.84e-24
Family ABC transporter ATPase domain-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA18437   Protein: JA39378   Gene: WBGene00137641
Sequence length 142
Comment JA39378 WBGene00137641 status:Partially_confirmed
Sequence
MMKEFPDVKEKEEMRKIVGRYGITGREQVCPMKQLSDGQRCRVSFAWLAWQQPHLLLLDE
PTNHLDMESIDALAEAINCFSGGLILVSHDFRLVSQVAEQVWVCDNQGIQKWEGDIFSFK
EHLRKQIDKDVVNREKGLVKER
Download sequence
Identical sequences K7H9J5
281687.CJA18437 CJA18437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]