SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA18716 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA18716
Domain Number 1 Region: 281-508
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.48e-29
Family GDI-like N domain 0.0000371
Further Details:      
 
Domain Number 2 Region: 5-40
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000013
Family GDI-like N domain 0.0066
Further Details:      
 
Domain Number 3 Region: 6-120
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000777
Family GDI-like N domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA18716   Protein: JA36206   Gene: WBGene00137921
Sequence length 671
Comment JA36206 WBGene00137921 locus:Cjp-rep-1 status:Partially_confirmed
Sequence
MDEKLPESVDVIVLGTGLPEAVLASACARAGLSVLHLDRVYCQILGFVVFAHFWGYSNLF
FCPFLEFYFFLVPSLATEFYFNTKAHENWLFLHFTVKFSVSRCLHTFGGTVIFFCRFLEF
YFFLLPSLATELYFNAQVYENWLFLYFTVKFSVSRCLHISGSTCPVWPLSSILLPKFMKI
GFFCILLSNLVFHGVFYCQILGFVVFAHFWGYSNLFFCPFLEFYFFLVPSLATDSILLPK
FMKIGFFCILLSNLVFHGVFYCQILGFVVFAHFWGYSNLFFCPFLEFYFFLVQTLCDSQV
SHYAEFKLINRQLCPTTSSSDGHITLNSVPCSKGEIFQNSALSILEKRALMKFITFCTQW
RGKPDAERRELLGAHADRPFGEFLKEMGVGETLQEFIINTIGILQPRPTAMTGMLASCEF
MDSVGHFGPSPFLFPLYGCGELAQCFCRLAAVFGSLYCLGRPVQAMIKKDGRVIAIIANN
ERINCRHVIMSARFVPEDVPILETSEIERIVYATDKSIKEAQKEQLTLINLASLRPEAAI
SRIVEVGFEACTAPKGHFLVHATGTREGETSIEKVAGQILAINNVQPYWKMSFTGKTLKF
DTTAGELAENVILAPQVDASLHYSHVVEECREIFCKNWPDLDFLPRTIKNDEENEEEVEK
TATGEENQVEN
Download sequence
Identical sequences 281687.CJA18716 CJA18716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]