SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA18770 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA18770
Domain Number 1 Region: 26-364
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.5e-62
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000188
Further Details:      
 
Domain Number 2 Region: 371-487
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.72e-43
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA18770   Protein: JA16007   Gene: WBGene00137974
Sequence length 495
Comment JA16007 WBGene00137974 status:Confirmed
Sequence
MSLSRTTQLPFAKVQFFKVLSRGYSSSQDADLVVIGGGPGGYVAAIKAAQLGMKTVCIEK
NATLGGTCLNVGCIPSKALLNNSHYLHMAQHDFAARGIDCTASLNLPKMMEAKANSVKQL
TGGIKQLFKANKVGHVEGFGSIVGPNTVQAKKNDGSVETINSRNILIASGSEVTPFPGIT
IDEQSIVSSTGALSLGQVPKKMVVIGAGVIGLELGSVWQRLGAEVTAVEFLGHIGGVGID
DEVAKTFQRTLTKQGFKFLLNTKVLGASKSGSTISVEVEGAKDGKKQTLTCDTLLVSVGR
RPYTEGLGLANVQIDLDSRGRIPVNERFQTKVPSIFAIGDVIEGPMLAHKAEDEGILAVE
GIAGGGVHIDYNCIPSVVYTHPEVAWVGKSEGQLKTEGVAYKIGKFPFVANSRAKTNNDQ
EGFVKVIADKQTDRMLGVHIIGPNAGEMIAEATLAMEYGASAEDVARVCHPHPTLSEAFR
EANLAAYCGKAINSI
Download sequence
Identical sequences A0A2H2IN90
281687.CJA18770 CJA18770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]