SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA18841 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA18841
Domain Number 1 Region: 1-355
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.42e-62
Family GDI-like N domain 0.00000000803
Further Details:      
 
Domain Number 2 Region: 390-435
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000919
Family GDI-like N domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA18841   Protein: JA00939   Gene: WBGene00138046
Sequence length 444
Comment JA00939 WBGene00138046 locus:Cjp-gdi-1 status:Confirmed
Sequence
MDEEYDAIVLGTGLKECIISGMLSVSGKKVLHIDRNNYYGGESASLTPLEQLYEKFYGAN
AKPQPEMGRGRDWNVDLIPKFLMANGPLVKLLIHTGVTRYLEFKSIESSFVVKGGKIYKV
PADEMEALATSLMGMFEKRRFKKFLVWVQQFDENNQDTWNGLDPHNNTMQQVYEKFGLDE
NTADFTGHALALYRDDEHKTQPFAPAVEKIRLYSDSLARYGKSPYLYPLYGLGELPQGFA
RLSAIYGGTYMLDKPVDEIVIEGGKAIGVKCGEEIVRGKQIYCDPSYAKDRVKKTGQVVR
AICLLNHPIPNTNDAQSCQIIIPQKQVGRHYDIYISCCSNTNMVTPKGWYLAMVSTTVET
ANPEAEVLPGLQLLGTIAEKFIQISDVYEPTDMGTESQIFISQSYDATTHFETTCKDVLN
MFERGTTKEFDFTNITHLSLNDQD
Download sequence
Identical sequences H2WQ30
CJA18841 281687.CJA18841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]