SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA19668 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA19668
Domain Number 1 Region: 5-73
Classification Level Classification E-value
Superfamily Homeodomain-like 5.49e-18
Family Tetracyclin repressor-like, N-terminal domain 0.0043
Further Details:      
 
Domain Number 2 Region: 81-194
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 3.19e-17
Family Tetracyclin repressor-like, C-terminal domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA19668   Protein: JA38365   Gene: WBGene00175239
Sequence length 207
Comment JA38365 WBGene00175239 status:Predicted
Sequence
MAKKQNPSTKPNLLDAALTVIRTKGYAATTVDDICTEAGLSKGAFFHHFSSKGDLAVAAA
NYWSETTAELFAAAPYHEPADPLDRVLAYIAFRKELIQGTLPEFTCLVGTMAQETYGTSP
VIQKACWESIAGHAETLVADIEAAIEQYGASHDFTAESLALHTQAVIQGAFILAKASGDP
RRATESLDHLYRYLELLFNRKTIIQTV
Download sequence
Identical sequences 281687.CJA19668 CJA19668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]