SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA19818 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA19818
Domain Number 1 Region: 17-85
Classification Level Classification E-value
Superfamily Homeodomain-like 6.67e-17
Family Tetracyclin repressor-like, N-terminal domain 0.0054
Further Details:      
 
Domain Number 2 Region: 86-208
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.00000000000000245
Family Tetracyclin repressor-like, C-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA19818   Protein: JA31069   Gene: WBGene00175389
Sequence length 211
Comment JA31069 WBGene00175389 status:Predicted
Sequence
MVESRRNNRTDSTGNVVILETAAQCFMEQGFSTTSIDDVARRMGSTKGRIYHYYSSKTDL
FFDVHREGMDRLFKAVEPVMTMNGSGLHRLEEMLMAHALAMMTNVAFEAVVVQGVHMHKL
AATTPDQRRTLNDLISIRRRFEDLFKQIIRDGIDDGSIREVDVSIAAKAVLGAINWLSIW
YQPRSAETESDKIALAKEIVNIQINGLRRSN
Download sequence
Identical sequences 281687.CJA19818 CJA19818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]