SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA19880 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA19880
Domain Number 1 Region: 39-248,355-401
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.81e-30
Family FAD-linked reductases, N-terminal domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA19880   Protein: JA28452   Gene: WBGene00175451
Sequence length 409
Comment JA28452 WBGene00175451 status:Predicted
Sequence
MPNHDVATRKDKLRTGTPFWIRTPNSTLQADRHLPRKVFDIIVVGAGISGALTAEALTRM
GKSVLIVDRRAPARGSTSASTAMIQHEIDVPLTRLRRTIGEQSANVAWLRSARAVRDLVD
LSAMLGLNCGMQPKSALYLAGDDMGARALASEAAARNKIGINADYLSRSTLFERFGIDRP
AAILSDISASANPAQLTAGLLRTVLTRNAQLASPIEITDMAELPFGVALATRQGEVLVAE
HIVFCTGYEYLPQMEAKSHSITSTWALASKPLRSMPPWLGGMLVWEAADPYLYLRTDEFG
RIIAGGEDEQAQGSNDDPKKMAAKATIIMRKLQNLIGVTIDMPDYVWAAPFGVTKDGLPI
IDRVPGYERVFAAMGFGGNGITFAMIAAQNITAAIAGEPVPDAELFRYR
Download sequence
Identical sequences 281687.CJA19880 CJA19880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]