SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA20098 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA20098
Domain Number 1 Region: 30-314
Classification Level Classification E-value
Superfamily NadA-like 5.36e-104
Family NadA-like 0.000000793
Further Details:      
 
Domain Number 2 Region: 310-553
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.54e-41
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0000835
Further Details:      
 
Domain Number 3 Region: 527-638
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4.34e-34
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA20098   Protein: JA27173   Gene: WBGene00175669
Sequence length 646
Comment JA27173 WBGene00175669 status:Predicted
Sequence
MNEFVSVSKLYDRVASVLPKAEWMGFEDDVAAILELKRKRNAVILAHNYQTPEIFHCVAD
IVGDSLALARKAIDVEADVIVLAGVHFMAETAKLLNPKKTVLIPDMGAGCSLADSITPQD
VALLREAHPGVPIITYVNTSAAVKAASDICCTSGNAKKVVESLGVPRVLMIPDEYLAQNI
ARETHVEILAWHGHCEVHERFTPDDIRELRESHPGVMVLAHPECPPEVVEAADFAGSTAV
MSDFVGEKKPQRVVLLTECSMSDNVAVDHPEVEFIRPCNLCPHMKRITLANIRQALEENR
HEVTVDAAVADTAPVIVIGSGLAGLMTALTLAPQPVLLVTAGTFAFDGSSALAQGGIAAS
LGDDDSPALHLADTLAAGAGLCDAAVAKNIIEAAAEAIATLEDYGVRFDSKPGGSYALGL
EAAHSRHRIVHVDGDATGAGIMRVLAAKVRATQSITIKENTRALRLIKQDGRVAGVELEG
IGPIAGRAVVLATGGAGGLYEATTTPLGNLGQGAALAGRAGAMLADMEFVQFHPTALAVS
ASRLPLISEAVRGEGAILVNDRDERFMRDIPGQELAARDIVARAIGRQLAQGHKVFLDAR
ASLDKGFAKRFPGIDALCKQYGIDPSCDLMPVRPATHYHIGGRGYR
Download sequence
Identical sequences CJA20098 281687.CJA20098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]