SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA20794 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA20794
Domain Number 1 Region: 2-85,227-286
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.33e-29
Family FAD-linked reductases, N-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA20794   Protein: JA38029   Gene: WBGene00176366
Sequence length 296
Comment JA38029 WBGene00176366 status:Predicted
Sequence
LKGGMITPLDGRAEPQKAVPAFAAKAQELGAVILQNCAVRGIETTNGRVSAVLTEKGRVA
CEAIVVAGGAWSRLIISDFKARLPQLKVKSSVFRTAPIEANVDPAIAFSDFALRKRLDGG
YTVASLGGSIADIVPDSFRFFRDFLPSLSTEWKSLRFRFGERFFEEAFQWKLRPADQVSI
FEKIRTLDPEPHRAANAAVLAKLKAAIPSFASATIAQEWAGLIDTMPDVIPVISPLPDID
GLIVATGFSGHGFGIGPGAGRLVADMVSGETPVVDPSPFHISRFSDGSKIRIENWG
Download sequence
Identical sequences 281687.CJA20794 CJA20794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]