SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA20805 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA20805
Domain Number 1 Region: 8-290
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 1.31e-52
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA20805   Protein: JA30021   Gene: WBGene00176377
Sequence length 294
Comment JA30021 WBGene00176377 status:Predicted
Sequence
MTLGAKGSWSFILTFRGTKLAAMVLVAYSIAVSTVLFQTVTNNRILTPSIMGFDALYILI
QTLAVFAFGAIHVNGIGPNARFFAETAIMVVFASTLYAWLFSGAARSLHLVMLVGIVFGV
FFRSLSNLMQRMIDPNEFAILQDRFFASFNSVNADILLLAAIIVAAVTLYGLRFLNVFDV
LSLGRDPAINLGVDHSRVVHRILLIVTILVSVSTALVGPITFFGLLVANLAYMIAGTSKH
RVVLPVAVLLAILCIVGGQTILERVFSFNTALSVIIEFLGGLVFIILLVRGNAR
Download sequence
Identical sequences CJA20805 281687.CJA20805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]