SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA20861 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA20861
Domain Number 1 Region: 101-189
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 5.36e-18
Family KorB DNA-binding domain-like 0.0049
Further Details:      
 
Domain Number 2 Region: 11-109
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 0.000000000000174
Family ParB-like nuclease domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA20861   Protein: JA38459   Gene: WBGene00176433
Sequence length 651
Comment JA38459 WBGene00176433 status:Predicted
Sequence
ITAMSTEKNFLEIPLAKLEVSPSNVRKTDADKIDDLLGSIPVHGLLQSLVIVPGDKAGHY
HVIAGGRRLRALQSLAKSKKLPKGYLVPCRLAEDGQDHEQLSLAENAIRAAMHPADQFEA
FAAQIDAGKNIADVAQAFGVSETIVKKRLKLGRVAPEILAAFRADELNLDQVAAYAITDD
QERQRDVFASNPNAHSNMIRNSLTQGEVPASDSRVRFVGLETYTAAGGAIHHDLFAEGDR
GTFLTDVALLDRLAAEKTEALIAEVKAEGWKDVFLFEGQYWQLSEAYKGRIYPQPIELSA
EDQETYDALVARMEEIEAELEQGDSDELRAEYEQLSHSVDQFKTTDYLPDEKATASAAIV
KDYNGNIKIERGLLKAASKTASLIGEERPASADGLPAPSAKMQTELGAVRTAAIAADLCD
NTHVALAVTVHSLASTYFGLYANVSATTYKGERADAAGQIQNRKMRPLAVLDERQEALRE
RLPERPADWWPYFLEMSHDDLMQHLALFTALSLRPFGQFALSSAKVHGDQIAEALGTKPE
TWVTLSDLEFLSRSRKSAILAAVEKIKGKDRAENISGLKKADLVERATAELDGKWLPAEL
SGFASETDRAVTASMDARSPYSHYYNEDQDEDDEEIDLESNEGEDGTNLAA
Download sequence
Identical sequences CJA20861 281687.CJA20861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]