SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA20943 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA20943
Domain Number 1 Region: 14-206
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.42e-29
Family FAD-linked reductases, N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA20943   Protein: JA19414   Gene: WBGene00176515
Sequence length 218
Comment JA19414 WBGene00176515 status:Predicted
Sequence
MDITNHPGSSKRLKIAVIGSGISGLSAAWLLSQRHDVTVFEAANRIGGHSNTVEFASSAG
SVAVDTGFIVYNEVTYPNLTALFRTLEVPTVSSNMSFAVSVGNGAYEYSGGTGLGLFAQR
SNLVSPRFWSMIRDLLRFYRNAPKDMKMMGSNSLDDYLTRNGYGRAFREDHLYPMAAAIW
STPAMEVGRYPAASFVRFCCNHGLLDRAGRRFGDGGRR
Download sequence
Identical sequences CJA20943 281687.CJA20943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]