SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA21056 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA21056
Domain Number 1 Region: 21-234,376-438
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.92e-62
Family FAD-linked reductases, N-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA21056   Protein: JA37208   Gene: WBGene00176628
Sequence length 443
Comment JA37208 WBGene00176628 status:Predicted
Sequence
MKPLSIPVAPFAGDETLPKAVDVVIIGGGIVGITTALELAERGISVAVCEKGVIAGEQSA
RNWGWTRQMGRDERELPLCMHSVNLWSQMNARIGRETGWRRTGISYLSYTQRELKDWLAW
AEIGKRHGVDARMLTPAEIAEKIPGNNGNLLGVLHTGTDGRAEPWIAVPAMAEAAREKGA
HILTHCAVRGVETAAGRVSSVVTERGEIRCQAVVLAGGIWSRLFAGNMGIDFPQLKVIGP
VARVDGVEGLTDMPVGAGDFAYRKRLDGSFTIAVRNLNLAPITPDHLRLFTEFAPTYLTT
WRELSLRFNAAFFQELATKRKWRLDEQTIFEQCRVMDPPANSGFTRKALRNMTLRFPGFA
KARVLNEWSGVIDATPDAIPVISPVHHLPGFHIASGFSGHGFGIGPGAGQLMADLITGSP
TSVDSKVFDISRLRPRYAKKNVA
Download sequence
Identical sequences 281687.CJA21056 CJA21056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]