SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA21362 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA21362
Domain Number 1 Region: 18-109
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000294
Family Anti-sigma factor antagonist SpoIIaa 0.0055
Further Details:      
 
Weak hits

Sequence:  CJA21362
Domain Number - Region: 196-269
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 0.0243
Family DmpA-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA21362   Protein: JA38542   Gene: WBGene00176934
Sequence length 391
Comment JA38542 WBGene00176934 status:Predicted
Sequence
MLTDAADKASAAANVAPKIDLAEHDGARLISLSGRWISQSVSIVDKKMRELEKVGGSQAV
IIDATDVAGLDTAGAWLIERLRQKLLSQEIDVRLEGVKPAWLPLMEEVGNSVVRTLDVPQ
TKKPFFIISMLDAIGRGVTSIYEDFLMAMHILGATIRGAQLKAGRGTGIPIPAIVKQMDR
MGVGAIPIIILMSTIVGAIIAQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAG
RSGSAITAEIGSMKMREETDALTVIGLNPVGVLVFPRLVALVVILPLLTIIADLSALIGA
AAVAWFYSNISPEAFISRLHDAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESL
GRRVTASVVKAIFVVIVVDGMFAMFYAAIDF
Download sequence
Identical sequences WP_024898714.1.22424 CJA21362 281687.CJA21362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]