SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA21385 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA21385
Domain Number 1 Region: 4-66,119-270
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.32e-31
Family FAD-linked reductases, N-terminal domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA21385   Protein: JA23633   Gene: WBGene00176957
Sequence length 334
Comment JA23633 WBGene00176957 status:Predicted
Sequence
MTGNVIVVGAGIIGSTTALRLAEAGLKVTLCDGSQPGGEQSASYGNGGWISPASIIPMSM
PGLWRQVPGFLLDRNGPLTLDWKSVPRLTPWLMRFLLAGATKSRVTKTAAKLNWLLNDGP
KRHLELARKTGQEHLIVQKGLLYAYPDRAAFEVEALSWKLRRDNGILFDEWQEAELRERI
PALGSNYRFAIHVTEGAHCLDTGGYVAGIVAQAEKADVRFIRRNVVRVLTGVSPRVVLDN
DESIAADHIVLAAGIHSGRIMHDLGMHVPMQSERGYHVTLPMTEVPFDIPIMPSTGRMGN
TPTNMGLRLSGQVELATVEKAPDWRRSEVLLNTR
Download sequence
Identical sequences CJA21385 281687.CJA21385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]