SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA21393 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA21393
Domain Number 1 Region: 18-216,297-328
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.06e-26
Family FAD-linked reductases, N-terminal domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA21393   Protein: JA37445   Gene: WBGene00176965
Sequence length 616
Comment JA37445 WBGene00176965 status:Predicted
Sequence
MSFAVSVGNGAYEYSGGTGLGLFAQRSNLVSPRFWSMIRDLLRFYRNAPKDMKMMGSNSL
DDYLTRNGYGRAFREDHLYPMAAAIWSTPAMEVGRYPAASFVRFCCNHGLLDLRGRPIWR
TVEGGSREYVKRITKPYADNIKLSTPIKTVRRSGNAVELVDGNGVSYAFDDVVIATHADQ
ALRMLDDPSVEESHILGAFQYSRNEAVLHRDASLMPKRRAAWSSWNYLTNSATGPSQPSI
TYWMNRLQPLGAAPDMFVTLNPCRALREDLVIRREIYEHPIFDMATDRAQKEIWSLQGRR
RTWFCGAHFGSGFHEDGLQAGLAVAEDLGGLRRPWQVEQESARIGKGAGMTELFQSALFP
GHVTHTRLRPKVHKLGYKIYSLLLDLDELEALHSRLRLFSVNRFNLFSFHEKDRGNGSVT
PLREQVEDAMRGAGIEPDGGAIRLLTMPRILGWAFNPLSVFFCYNRGGELTAILWEVDNT
FKQRHGYMIPVDGEQNGRIVQSCDKAFYVSPFMDMKLRYEFEVLSPADKLMIRINSFDDE
GLLLTARHLARRVKLSDAALLRAFFTIPFLTLRVVGGIHWEALKIWAKGIGFRKRPQPPQ
FPVTHIRTENPPQRNR
Download sequence
Identical sequences 281687.CJA21393 CJA21393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]