SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA21641 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA21641
Domain Number 1 Region: 3-310
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.41e-44
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00073
Further Details:      
 
Domain Number 2 Region: 313-406
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 2.47e-25
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA21641   Protein: JA29179   Gene: WBGene00177213
Sequence length 410
Comment JA29179 WBGene00177213 status:Predicted
Sequence
MDNRCIIIGAGHAGSQAAVSLRQEGYAGEIVLINDELDLPYHKPPLSKSYLKAPESGVLV
LRPENTYRDNNIEMLFGRRVDGVSLTDKTVTLDDGSILAWSELVFATGARARIPDVPGVG
LDGVVTLRRLEDARRIADMMPNVQNVVIIGGGFIGLEMAHSAIALGKKTVLIEAAPRVLG
RSVATHISTHVEARSRAADITLLTGLGVTSIEGENGRVTGVAATDGTVFAADMVVLGTGA
VPNVELATQAGLAIDNGIVVDEYMRTSSEHVYAIGDCVSYAHFHAGRRVRLESVQNATDQ
AKHVARSIVGRGTPFRDVAWFWSDQGDMKLQTAGLSFDADRHILSGNLEDNAFSVFHFAG
DKLIAVDSVNRPADHMIARRLLAAGISPTEEDITAGAARLKELLASAPKA
Download sequence
Identical sequences 281687.CJA21641 CJA21641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]