SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA21811 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA21811
Domain Number 1 Region: 3-305
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 9.42e-63
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.0000248
Further Details:      
 
Domain Number 2 Region: 299-402
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.00000000141
Family Ferredoxin reductase FAD-binding domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA21811   Protein: JA19224   Gene: WBGene00177383
Sequence length 529
Comment JA19224 WBGene00177383 status:Predicted
Sequence
LVGLLLILLLLIVFSACMGRGEHGWVFQGAEHLDFIGRWRAPRIISSLGAGLLLGLAGVF
VQRMFGNSMASPEVLGISSGASLGVITLVLLLPLYQPASVIAAAAIGALGTTGFVLLLNN
RFGYSPQRTILFGVALGTLLGAISEFLIAGGGSARTLLLTWMSGSTYRADWGTATSVLVV
AAVALLILPLFGRWLTLLPLGESTARSMGLDVKGARGQIILAASLMTAAATIVVGPLSFI
GLMAPHIARAAGFRKTMSQLYAAAIFGAIILVAADLLGRIIIFPWQVPAGLLSALIGGPY
FLTMIIIGKKWISSSIIRLVFGGDGLAEFKSLGIADEWIRFVFRIGHTYTTRPYTVRYWD
AQTLQMTVDIIMHDGGIAADWASSALIGSLIEFTGPEGRYQPPHSISWVLLLADITGLPA
AGRIIETSPRSVVIHSHICLPDMRDMQRDLEHEHSSLITWHSDTHGGPTAAPLSQIAKNV
VLPEGEGYIWIAGEANQVADARAHFRDEKGFDKNRITAIGYWFEGRPRE
Download sequence
Identical sequences CJA21811 281687.CJA21811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]