SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA21859 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA21859
Domain Number 1 Region: 22-283,335-396
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.56e-37
Family FAD-linked reductases, N-terminal domain 0.049
Further Details:      
 
Domain Number 2 Region: 249-342
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000373
Family D-aminoacid oxidase-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA21859   Protein: JA35318   Gene: WBGene00177431
Sequence length 519
Comment JA35318 WBGene00177431 status:Predicted
Sequence
MNYIRFGGWRRSSGFAMVQNKIFDIFVIGGGINGCGIARDAVGRGFSVGLAEMNDLASGT
SSRATKLIHGGLRYLEHYEFRLVREALMEREVLWANAPHLIHPMRFVLPFHKGGVRPAWL
LRLGLFLYDHLGGRKKLPATRTLDMRTDPSAAPLKPLFTKAFEYSDCWVDDARFTALTAR
DAADRGAMIRTRTKVVSARRDHEAWTVTLENIDTGAREEVRARLLVNAAGPWADKVLQGV
EGDRQLHNVRLVQGSHIVVRKKFSDPRSYFFQNNDGRIIFAIPYEDDFTLIGTTDQDYQG
DPAKVAISDKETDYLCACASEYFKESVRLEDIVWTYSGVRPLYDDGASKAQEATRDYVLK
EDASQGAAPLINVFGGKLTTARRLAEHMLEKIEHHLGKKGAPWTHAAPLPGGDFQEVAFD
RELEKLKAAYPFLSPIHARRLFRLYGTRARALLGETSSLADLGRHFGADLYEAEVRYLIE
NEWAHTAEDILWRRTKLGLRLNSSEVSALQAFLKPVKAA
Download sequence
Identical sequences CJA21859 281687.CJA21859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]