SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA22004 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA22004
Domain Number 1 Region: 11-51
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000000713
Family FAD-linked reductases, N-terminal domain 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA22004   Protein: JA30248   Gene: WBGene00177576
Sequence length 52
Comment JA30248 WBGene00177576 status:Predicted
Sequence
MIGHRLARWRRNYSTAVANADVVVCGGGISGTSIAYHLAKKGKKVALVEKDS
Download sequence
Identical sequences CJA22004 281687.CJA22004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]