SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA22710 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA22710
Domain Number 1 Region: 77-181
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 8.45e-18
Family Tetracyclin repressor-like, C-terminal domain 0.0011
Further Details:      
 
Domain Number 2 Region: 4-78
Classification Level Classification E-value
Superfamily Homeodomain-like 8.98e-17
Family Tetracyclin repressor-like, N-terminal domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA22710   Protein: JA22392   Gene: WBGene00178282
Sequence length 187
Comment JA22392 WBGene00178282 status:Predicted
Sequence
MSSSSREAILAAARRTAQAHGYNGLNFRELADEVGIKAASIHYHFPSKADLGAAVAKRYW
EDSAAVLEALLAGSTDPICWLREYPNTFRKALENENRICLCSFMAAEYDDLPETVKKEVL
AFTDVNVAWLSRVLSAATAMSSEESEARSRAIFAAVAGAQLMARSRSDIAVFDALIDSYR
AAGLLPA
Download sequence
Identical sequences 281687.CJA22710 CJA22710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]