SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA22820 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA22820
Domain Number 1 Region: 28-294,393-455
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.12e-76
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.000000581
Further Details:      
 
Domain Number 2 Region: 485-646
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 2.62e-42
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00017
Further Details:      
 
Domain Number 3 Region: 271-389
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 9.72e-41
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.0000082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA22820   Protein: JA33646   Gene: WBGene00178392
Sequence length 646
Comment JA33646 WBGene00178392 locus:Cjp-sdha-1 status:Partially_confirmed
Sequence
MLRAASTGVRNAVATRSVSLSAVNHSDAKRSDIAQYKVVDHAYDAVVVGAGGAGLRAAMG
LSEGGLKTAVITKLFPTRSHTVAAQGGINAALGNMNPDNWRWHFYDTVKGSDWLGDQDAI
HYMTREAERAVIELENYGMPFSRTTDGKIYQRAFGGQSNDFGRGGQAHRTCCVADRTGHS
LLHTLYGASLQYNCNYFVEYFALDLIMENGTCVGVIAMDLEDGTIHRFRSKNTVLATGGY
GRAFFSCTSAHTCTGDGTALTARAGINNSDMEFVQFHPTGIYGAGCLITEGSRGEGGFLV
NSAGERFMERYAPVAKDLASRDVVSRSMTVEIMEGRGVGPEKDHIYLQLHHLPSEQLQQR
LPGISETAMIFSGVDVTKEPIPVIPTVHYNMGGVPTNYKGQVLNYSSEKGDQVVPGLYAA
GECGAHSVHGANRLGANSLLDLVIFGRACAIDILKNTTPGVGVPELPKNAGEASVANVDK
LRYNKGDISTAELRLNMQKSMQKHAAVFRRGDILQEGVKVLSKLYKEQANLKVADKGLVW
NSDLVETLELQNLLINATQTIVAAENRKESRGAHARDDFPDRLDELDYSKPLEGQTKKEF
KDHWRKHSIIRSNIETGEVSLDYRPVIDTTLDKSETDWVPPKVRSY
Download sequence
Identical sequences A0A2H2IRS0
281687.CJA22820 CJA22820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]