SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA22958 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA22958
Domain Number 1 Region: 29-103
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000971
Family FAD-linked reductases, N-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA22958   Protein: JA34136   Gene: WBGene00178530
Sequence length 104
Comment JA34136 WBGene00178530 status:Partially_confirmed
Sequence
MLHASRSLVRCSSLDHQLRHSSTKHVFACVLGSGVAGSSVAYHLTKRNIKDVLLLDRASG
VASPTGTSFHSPGLVSASHPAHRYKPILAHSIELYSKLEAETGV
Download sequence
Identical sequences 281687.CJA22958 CJA22958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]