SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA22969 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA22969
Domain Number 1 Region: 16-68,121-279,368-383
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.18e-36
Family FAD-linked reductases, N-terminal domain 0.057
Further Details:      
 
Domain Number 2 Region: 283-368
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.0000000288
Family D-aminoacid oxidase-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA22969   Protein: JA31082   Gene: WBGene00178541
Sequence length 384
Comment JA31082 WBGene00178541 status:Predicted
Sequence
RALSCDGIGGNTMQQQDVIVLGAGIVGVSAALHLQARGRSVVLVDRGEPGQGTSFGNAGL
IERSSVIPYSFPQGFGTLLRYGLNRRSDVRYNPFYVSRIARWLFQYWRESSPERLKIATN
AMLPLIEASVREHDVLIAQAGCERLVRSQGWIEVFRNEPAFNAAVQRLPQLQSYNLAYDV
LDSNTLRQRETTLGAVAGGIHWLDPKTIVNPGGLVQAYADLFRQNGGTFVHGDAASLVEA
GNGWQMTTEQGPISARDVVVALGPQSGLIFQKFGYAIPLGIKRGHHMHFEMQDGARLGHT
LVDEEAGYVLAPMVQGVRLSTGIEFASPDAPANFIQLKRAEKVARRLLPQLGNAVEAKPW
LGLRPCLPDMRPVIGPAPRHKGLX
Download sequence
Identical sequences CJA22969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]