SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA23239 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA23239
Domain Number 1 Region: 98-146,176-237
Classification Level Classification E-value
Superfamily L,D-transpeptidase catalytic domain-like 1.16e-29
Family L,D-transpeptidase catalytic domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA23239   Protein: JA25935   Gene: WBGene00178811
Sequence length 238
Comment JA25935 WBGene00178811 status:Predicted
Sequence
MHTTLTRRSFLTAMTATAAAGLAGCAQLGQNVPIVDVDASGNPINRTPQANVDASYGSWA
SMYAAVEDNGFQLPAIPIQKMDKRFLRQVVQDPTGEMPGTIVVDTTNRFLYLVLGNGQAM
RYGVGIGRDGFAWSGRAVIQYKREWPRWTPPDEMVARQPELEPYSSRNGGMAPGLKNPLG
ARALYIFKDGKDTIYRLHGNPEWWSIGKAVSSGCVRLMNQDIIDLYNRVPAKSPILVM
Download sequence
Identical sequences 281687.CJA23239 CJA23239 WP_024897248.1.22424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]