SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA23420 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA23420
Domain Number 1 Region: 9-193,337-396
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.39e-40
Family HI0933 N-terminal domain-like 0.0026
Further Details:      
 
Domain Number 2 Region: 195-338
Classification Level Classification E-value
Superfamily HI0933 insert domain-like 0.00000000000719
Family HI0933 insert domain-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA23420   Protein: JA39377   Gene: WBGene00178992
Sequence length 562
Comment JA39377 WBGene00178992 status:Predicted
Sequence
MRERIISIFGGGPAGLFAAERLSALGHSVTVYEQMPTVGRKFLLAGKSGLNITHSEEFTQ
FAQRYGASNDHLLPALQQFTPQNLRDWADALGAETFVGSSGRVFPKAMKASPLLRAWVRR
LEAQGVKVLTRHKWIGFSSGKPLVQTSNGIEPVSCDAALFAFGGASWPKLGSNGVWSEIF
AEQDIQIAPMRPANCGFDVSWSDIFAERFAGEPVKSVTITSKAGTTQGEFVITRGGVEGS
LVYAHSAALRDELEQKGQANLVLDLAPGRTIERLAHDLSRQDKKLSISNILRKGAGLTGV
KAALVLEFQREKDPTKLAQTIKSLAIPLVRPRPIEEAISSAGGIKWNELNEHYMLKKLPG
MFVAGEMVDWEAPTGGYLLTACFAMGLAAANGIDNWLRNKVTGSIVLIAILGVVLWLGFK
PPELLKVGTGYAAKIVCSNVFLAHRDAEAVLADDVQAPGHPLLKYLNVSVNQAHQSVIVH
IFGFFAPSKAVYRPGLGCANIHDEDLRPDLQIPADAAALISDISINPTVQNIIENPALAG
PGMRAIAVLKNGEIICRNLWQG
Download sequence
Identical sequences CJA23420 281687.CJA23420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]