SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA23516 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CJA23516
Domain Number - Region: 32-112
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 0.0602
Family DmpA-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA23516   Protein: JA19301   Gene: WBGene00179088
Sequence length 182
Comment JA19301 WBGene00179088 status:Predicted
Sequence
VSKDTVKRRLRHALLFRRRPVNKPMIPEKNRSAGLNDESKYLMFGTDGVTLVQRQGLLPR
KWRRLTHPNHRNHGELNVQGHLGEGNDTIWKISDGYWVVVPTGQRSETLFPLFQGLDRTA
SSERYDLAKPISPPEFLRASLGGSCNSRKNGQNPTSDPDEFDRVHAKRCEAVIKVKGMAT
KY
Download sequence
Identical sequences CJA23516 281687.CJA23516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]