SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA23610 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA23610
Domain Number 1 Region: 191-327
Classification Level Classification E-value
Superfamily L,D-transpeptidase catalytic domain-like 1.83e-23
Family L,D-transpeptidase catalytic domain-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA23610   Protein: JA33627   Gene: WBGene00179182
Sequence length 329
Comment JA33627 WBGene00179182 status:Predicted
Sequence
MRSGKSVLDLSGMQKEFKMVGKKTLNTMVVALIVLPFLASNLNAETFDRVVILANTPKIT
RWAVIHQKPDPAHNDPYYHLEAFEHKKGAQPWVFKRLAHHMVITSEALEKSRNKKRAGTY
AYKDVEFWITYKMWRDNPEIRAQTPISTNMIRKILFAVVLIAVGLFGYTKVMARVGSGEP
PQSLPAEQQADAIKVYKGERRMTLLRDGAVIGTYRIALGGNGDGGHKSREGDQKTPEGAY
IIDWRNPRSMAHLSLHVSYPNTADQSAADAAGYAPGGNIMIHGLPNGWGWLASVHHLWDW
TDGCIGVTNTEMREIWSKVPNGTPIVIEP
Download sequence
Identical sequences CJA23610 281687.CJA23610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]