SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA23758 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA23758
Domain Number 1 Region: 1-73
Classification Level Classification E-value
Superfamily Homeodomain-like 2.31e-16
Family Tetracyclin repressor-like, N-terminal domain 0.0025
Further Details:      
 
Domain Number 2 Region: 82-186
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.000000000235
Family Tetracyclin repressor-like, C-terminal domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA23758   Protein: JA31129   Gene: WBGene00179330
Sequence length 209
Comment JA31129 WBGene00179330 status:Predicted
Sequence
MRRTKAEAAETRDAILTAAEHVFLERGVTQSTLMEIASHAGVTRGAIYFHFHDKLDVFQA
LISRTRFPHEEIMLQAAACDHPNPLYVLEQSILTAMELFITNERQQNVFTIIHQRCEYVG
ENAPVVEHLNEARTNVLSLFIGLLEVAERRGELSREWTSYTAAQILLAVLGGLLNEWLRS
ERSFDLVGSGNKAIKTMIQSMRSEQFAVS
Download sequence
Identical sequences 281687.CJA23758 CJA23758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]