SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA24076 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA24076
Domain Number 1 Region: 48-111
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.32e-18
Family FAD-linked reductases, N-terminal domain 0.0054
Further Details:      
 
Domain Number 2 Region: 3-55
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.0000000000000373
Family GMC oxidoreductases 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA24076   Protein: JA38138   Gene: WBGene00179648
Sequence length 133
Comment JA38138 WBGene00179648 status:Predicted
Sequence
MSLEGLKIAREIMSQNALKPYVMAERLPGPKVVSDDDLFDYACANAKTDHHPVGTCKMGT
DAMAVVDLDLKVRGLEGLRVCDSSIMPRVPSCNTNAPTIMIGEKGADIIRGLDPLPPVVF
SWEKNEQKRRARI
Download sequence
Identical sequences 281687.CJA24076 CJA24076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]